Lineage for d3jvwb_ (3jvw B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2799131Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2800628Protein automated matches [190433] (12 species)
    not a true protein
  7. 2800746Species Human immunodeficiency virus type 1 (bru isolate) [TaxId:11686] [188980] (3 PDB entries)
  8. 2800752Domain d3jvwb_: 3jvw B: [178851]
    automated match to d1fgcc_
    complexed with dmp; mutant

Details for d3jvwb_

PDB Entry: 3jvw (more details), 1.8 Å

PDB Description: hiv-1 protease mutant g86a with symmetric inhibitor dmp323
PDB Compounds: (B:) Gag-Pol polyprotein

SCOPe Domain Sequences for d3jvwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jvwb_ b.50.1.1 (B:) automated matches {Human immunodeficiency virus type 1 (bru isolate) [TaxId: 11686]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniiarnlltqigatlnf

SCOPe Domain Coordinates for d3jvwb_:

Click to download the PDB-style file with coordinates for d3jvwb_.
(The format of our PDB-style files is described here.)

Timeline for d3jvwb_: