Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Myosin Regulatory Chain [47527] (2 species) |
Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47528] (15 PDB entries) Uniprot P07291 |
Domain d3jvtc_: 3jvt C: [178849] Other proteins in same PDB: d3jvtb_ automated match to d1qviz_ complexed with ca, mg |
PDB Entry: 3jvt (more details), 2.1 Å
SCOPe Domain Sequences for d3jvtc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jvtc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} pklsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmge kslpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsde dvdeiikltdlqedlegnvkyedfvkkvmagpypdk
Timeline for d3jvtc_: