SCOPe 2.01: Domain d3juia_: 3jui A:

Lineage for d3juia_ (3jui A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (24 families)

5. Family a.118.1.0: automated matches [191340] (1 protein)
   not a true family

6. Protein automated matches [190220] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189070] (1 PDB entry)

8. Domain d3juia_: 3jui A: [178836]
   automated match to d1paqa_
   complexed with gol

Details for d3juia_

PDB Entry: 3jui, 2 Å

PDB Description: crystal structure of the c-terminal domain of human translation initiation factor eif2b epsilon subunit

PDB Compounds: (A:) Translation initiation factor eIF-2B subunit epsilon

SCOPe Domain Sequences for d3juia_:

Sequence, based on SEQRES records:

>d3juia_ a.118.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ghhhhhhmddikvfqnevlgtlqrgkeeniscdnlvleinslkyaynislkevmqvlshv
vlefplqqmdspldssrycalllpllkawspvfrnyikraadhlealaaiedffleheal
gismakvlmafyqleilagetilswfsqrdttdkgqqlrknqqlqrfiqwlkeaee

Sequence, based on observed residues (ATOM records):

>d3juia_ a.118.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ghhhhhhmddikvfqnevlgtlqrgkeeniscdnlvleinslkyaynislkevmqvlshv
vlefplqqmdspldssrycalllpllkawspvfrnyikraadhlealaaiedffleheal
gismakvlmafyqleilagetilswfsqrddkgqqlrknqqlqrfiqwlkeaee

Timeline for d3juia_:

• d3juia_ is new in SCOPe 2.01-stable
  
• d3juia_ appears in SCOPe 2.02
  
• d3juia_ appears in the current release, SCOPe 2.08, called d3juia1