Lineage for d3juia1 (3jui A:548-715)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2726072Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2726073Protein automated matches [190220] (14 species)
    not a true protein
  7. 2726099Species Human (Homo sapiens) [TaxId:9606] [189070] (63 PDB entries)
  8. 2726120Domain d3juia1: 3jui A:548-715 [178836]
    Other proteins in same PDB: d3juia2
    automated match to d1paqa_
    complexed with gol

Details for d3juia1

PDB Entry: 3jui (more details), 2 Å

PDB Description: crystal structure of the c-terminal domain of human translation initiation factor eif2b epsilon subunit
PDB Compounds: (A:) Translation initiation factor eIF-2B subunit epsilon

SCOPe Domain Sequences for d3juia1:

Sequence, based on SEQRES records: (download)

>d3juia1 a.118.1.0 (A:548-715) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddikvfqnevlgtlqrgkeeniscdnlvleinslkyaynislkevmqvlshvvlefplqq
mdspldssrycalllpllkawspvfrnyikraadhlealaaiedfflehealgismakvl
mafyqleilagetilswfsqrdttdkgqqlrknqqlqrfiqwlkeaee

Sequence, based on observed residues (ATOM records): (download)

>d3juia1 a.118.1.0 (A:548-715) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddikvfqnevlgtlqrgkeeniscdnlvleinslkyaynislkevmqvlshvvlefplqq
mdspldssrycalllpllkawspvfrnyikraadhlealaaiedfflehealgismakvl
mafyqleilagetilswfsqrddkgqqlrknqqlqrfiqwlkeaee

SCOPe Domain Coordinates for d3juia1:

Click to download the PDB-style file with coordinates for d3juia1.
(The format of our PDB-style files is described here.)

Timeline for d3juia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3juia2