Lineage for d3juhb_ (3juh B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1042202Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1042203Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1042269Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1043374Protein Protein kinase CK2, alpha subunit [56142] (3 species)
    CMGC group; CK2 subfamily; serine/threonine kinase
  7. 1043375Species Human (Homo sapiens) [TaxId:9606] [75559] (27 PDB entries)
  8. 1043383Domain d3juhb_: 3juh B: [178835]
    automated match to d1jwha_
    complexed with anp, cl, gol; mutant

Details for d3juhb_

PDB Entry: 3juh (more details), 1.66 Å

PDB Description: Crystal structure of a mutant of human protein kinase CK2alpha with altered cosubstrate specificity
PDB Compounds: (B:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d3juhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3juhb_ d.144.1.7 (B:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
nekvavkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvlidhehrklrlidwglaef
yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
dkllrydhqsrltareamehpyfytvvkdqarmg

SCOPe Domain Coordinates for d3juhb_:

Click to download the PDB-style file with coordinates for d3juhb_.
(The format of our PDB-style files is described here.)

Timeline for d3juhb_: