SCOPe 2.05: Domain d3ju9a_: 3ju9 A:

Lineage for d3ju9a_ (3ju9 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Concanavalin A [49901] (4 species)
   natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop

7. Species Brazilian jackbean (Canavalia brasiliensis) [TaxId:61861] [49903] (5 PDB entries)

8. Domain d3ju9a_: 3ju9 A: [178830]
   automated match to d1azda_
   complexed with ca, cl, dbb, gol, mn

Details for d3ju9a_

PDB Entry: 3ju9, 2.1 Å

PDB Description: Crystal structure of a lectin from Canavalia brasiliensis seed (ConBr) complexed with alpha-aminobutyric acid

PDB Compounds: (A:) Concanavalin-Br

SCOPe Domain Sequences for d3ju9a_:

Sequence; same for both SEQRES and ATOM records:

>d3ju9a_ b.29.1.1 (A:) Concanavalin A {Brazilian jackbean (Canavalia brasiliensis) [TaxId: 61861]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtegnlrltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

Timeline for d3ju9a_:

• d3ju9a_ first appeared in SCOPe 2.01
  
• d3ju9a_ appears in SCOPe 2.04
  
• d3ju9a_ appears in SCOPe 2.06
  
• d3ju9a_ appears in the current release, SCOPe 2.08