SCOPe 2.08: Domain d3jtth1: 3jtt H:2-100

Lineage for d3jtth1 (3jtt H:2-100)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (7 species)

7. Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [384005] (5 PDB entries)

8. Domain d3jtth1: 3jtt H:2-100 [178826]
   Other proteins in same PDB: d3jtth2
   automated match to d1a9bb_

Details for d3jtth1

PDB Entry: 3jtt, 2.8 Å

PDB Description: Cystal structure of Rhesus macaque MHC class I:Mamu-A*02

PDB Compounds: (H:) Beta-2-microglobulin

SCOPe Domain Sequences for d3jtth1:

Sequence; same for both SEQRES and ATOM records:

>d3jtth1 b.1.1.2 (H:2-100) beta2-microglobulin {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
iqrtpkiqvysrhppengkpnflncyvsgfhpsdievdllkngekmgkvehsdlsfskdw
sfyllyyteftpnekdeyacrvnhvtlsgprtvkwdrdm

Timeline for d3jtth1:

• d3jtth1 first appeared in SCOPe 2.01, called d3jtth_
  
• d3jtth1 appears in SCOPe 2.07