Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.13: Cytidylytransferase [68901] (7 proteins) |
Protein automated matches [190992] (6 species) not a true protein |
Species Yersinia pestis [TaxId:214092] [189052] (1 PDB entry) |
Domain d3jtja_: 3jtj A: [178825] automated match to d1vh1a_ complexed with imd |
PDB Entry: 3jtj (more details), 2.18 Å
SCOPe Domain Sequences for d3jtja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jtja_ c.68.1.13 (A:) automated matches {Yersinia pestis [TaxId: 214092]} sfiaiiparyastrlpgkpladiagkpmvvhvmeralasgadrvivatdhpdvvkaveaa ggevcltradhqsgterlaeviehygfadddiivnvqgdeplvppviirqvadnlaacsa gmatlavpiasseeafnpnavkvvmdaqgyalyfsratipwererfaqsketigdcflrh igiyayragfirryvnwapsqleqielleqlrvlwygekihvavakavpavgvdtqsdld rvraimlnq
Timeline for d3jtja_: