SCOPe 2.08: Domain d3jtdc_: 3jtd C:

Lineage for d3jtdc_ (3jtd C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Myosin Regulatory Chain [47527] (2 species)

7. Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47528] (15 PDB entries)
   Uniprot P07291

8. Domain d3jtdc_: 3jtd C: [178822]
   Other proteins in same PDB: d3jtdb_
   automated match to d1qviz_
   complexed with mg; mutant

Details for d3jtdc_

PDB Entry: 3jtd, 2.57 Å

PDB Description: calcium-free scallop myosin regulatory domain with elc-d19a point mutation

PDB Compounds: (C:) myosin essential light chain, striated adductor muscle

SCOPe Domain Sequences for d3jtdc_:

Sequence; same for both SEQRES and ATOM records:

>d3jtdc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}
pklsqdeiddlkdvfelfafwdgrdgavdafklgdvcrclginprnedvfavggthkmge
kslpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsde
dvdeiikltdlqedlegnvkyedfvkkvmagpypdk

Timeline for d3jtdc_:

• d3jtdc_ first appeared in SCOPe 2.01
  
• d3jtdc_ appears in SCOPe 2.07