SCOPe 2.08: Domain d3jtdb_: 3jtd B:

Lineage for d3jtdb_ (3jtd B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein automated matches [190064] (21 species)
   not a true protein

7. Species Bay scallop (Argopecten irradians) [TaxId:31199] [189156] (2 PDB entries)

8. Domain d3jtdb_: 3jtd B: [178821]
   Other proteins in same PDB: d3jtdc_
   automated match to d1kk7y_
   complexed with mg; mutant

Details for d3jtdb_

PDB Entry: 3jtd, 2.57 Å

PDB Description: calcium-free scallop myosin regulatory domain with elc-d19a point mutation

PDB Compounds: (B:) myosin regulatory light chain, striated adductor muscle

SCOPe Domain Sequences for d3jtdb_:

Sequence; same for both SEQRES and ATOM records:

>d3jtdb_ a.39.1.5 (B:) automated matches {Bay scallop (Argopecten irradians) [TaxId: 31199]}
adkaasgvltklpqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltaml
keapgplnftmflsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnf
nkdemrmtfkeapveggkfdyvkftamikgsgeeea

Timeline for d3jtdb_:

• d3jtdb_ first appeared in SCOPe 2.01
  
• d3jtdb_ appears in SCOPe 2.07