SCOPe 2.03: Domain d3jtcb_: 3jtc B:

Lineage for d3jtcb_ (3jtc B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein automated matches [191280] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189896] (19 PDB entries)

8. Domain d3jtcb_: 3jtc B: [178820]
   Other proteins in same PDB: d3jtcc_, d3jtcd_
   automated match to d1lqvb_
   complexed with ca, mg, nag, ndg, pty

Details for d3jtcb_

PDB Entry: 3jtc, 1.6 Å

PDB Description: importance of mg2+ in the ca2+-dependent folding of the gamma- carboxyglutamic acid domains of vitamin k-dependent clotting and anticlotting proteins

PDB Compounds: (B:) Endothelial protein C receptor

SCOPe Domain Sequences for d3jtcb_:

Sequence; same for both SEQRES and ATOM records:

>d3jtcb_ d.19.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqrlhmlqisyfrdpyhvwyqgnaslgghlthvlegpdtnttiiqlqplqepeswartqs
glqsyllqfhglvrlvhqertlafpltircflgcelppegsrahvffevavngssfvsfr
peralwqadtqvtsgvvtftlqqlnaynrtryelrefledtcvqyvqkhisae

Timeline for d3jtcb_:

• d3jtcb_ first appeared in SCOPe 2.01
  
• d3jtcb_ appears in SCOPe 2.02
  
• d3jtcb_ appears in SCOPe 2.04
  
• d3jtcb_ appears in the current release, SCOPe 2.08