![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
![]() | Protein automated matches [190545] (9 species) not a true protein |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [187720] (5 PDB entries) |
![]() | Domain d3jtbc_: 3jtb C: [178817] automated match to d1azna_ complexed with cu |
PDB Entry: 3jtb (more details), 1.8 Å
SCOPe Domain Sequences for d3jtbc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jtbc_ b.6.1.1 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghswvlstaadmqgvv tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctnpghsal mkgtltlk
Timeline for d3jtbc_: