SCOPe 2.01: Domain d3jsca_: 3jsc A:

Lineage for d3jsca_ (3jsc A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (3 families)
   contains insert beta-sheet subdomain and C-terminal helix

5. Family b.34.6.1: CcdB [50119] (1 protein)

6. Protein CcdB [50120] (2 species)
   topoisomerase poison

7. Species Vibrio fischeri [TaxId:668] [189154] (4 PDB entries)

8. Domain d3jsca_: 3jsc A: [178757]
   automated match to d1vuba_
   complexed with so4

Details for d3jsca_

PDB Entry: 3jsc, 1.5 Å

PDB Description: CcdBVfi-FormI-pH7.0

PDB Compounds: (A:) ccdb

SCOPe Domain Sequences for d3jsca_:

Sequence, based on SEQRES records:

>d3jsca_ b.34.6.1 (A:) CcdB {Vibrio fischeri [TaxId: 668]}
sqftlyknkdkssaktypyfvdvqsdlldnlntrlvipltpielldkkapshlcptihid
egdfimltqqmtsvpvkilsepvnelstfrneiiaaidflitgi

Sequence, based on observed residues (ATOM records):

>d3jsca_ b.34.6.1 (A:) CcdB {Vibrio fischeri [TaxId: 668]}
sqftlyknkdkssaktypyfvdvqsdlldnlntrlvipltpiellcptihidegdfimlt
qqmtsvpvkilsepvnelstfrneiiaaidflitgi

Timeline for d3jsca_:

• d3jsca_ is new in SCOPe 2.01-stable
  
• d3jsca_ appears in SCOPe 2.02
  
• d3jsca_ appears in the current release, SCOPe 2.08