![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
![]() | Family d.58.6.0: automated matches [191597] (1 protein) not a true family |
![]() | Protein automated matches [191087] (19 species) not a true protein |
![]() | Species Babesia bovis [TaxId:484906] [189049] (1 PDB entry) |
![]() | Domain d3js9b_: 3js9 B: [178755] automated match to d1bhna_ complexed with so4 |
PDB Entry: 3js9 (more details), 2.5 Å
SCOPe Domain Sequences for d3js9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3js9b_ d.58.6.0 (B:) automated matches {Babesia bovis [TaxId: 484906]} mertyimvkpdgvqrgligeilkrfemkglkliaakfehptmdvvaqhycehkdkpffkd lcdfishgpvfcmiwegpeaikigrnlvgltspvesaagtirgdfgvvknfnivhasssa edaarecalwftpeqlvtwersvggwiy
Timeline for d3js9b_: