Lineage for d3js3c_ (3js3 C:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 972170Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 973199Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 973200Protein automated matches [190115] (26 species)
    not a true protein
  7. 973238Species Clostridium difficile [TaxId:272563] [189051] (1 PDB entry)
  8. 973241Domain d3js3c_: 3js3 C: [178752]
    automated match to d1gqna_
    complexed with dhs

Details for d3js3c_

PDB Entry: 3js3 (more details), 2.2 Å

PDB Description: crystal structure of type i 3-dehydroquinate dehydratase (arod) from clostridium difficile with covalent reaction intermediate
PDB Compounds: (C:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d3js3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3js3c_ c.1.10.0 (C:) automated matches {Clostridium difficile [TaxId: 272563]}
mkrkvqvknitigegrpkicvpiigknkkdiikeakelkdacldiiewrvdffenvenik
evkevlyelrsyihdipllftfrsvveggeklisrdyyttlnkeisntglvdlidvelfm
gdevidevvnfahkkevkviisnhdfnktpkkeeivsrlcrmqelgadlpkiavmpqnek
dvlvlleatnemfkiyadrpiitmsmsgmgvisrlcgeifgsaltfgaaksvsapgqisf
kelnsvlnllhks

SCOPe Domain Coordinates for d3js3c_:

Click to download the PDB-style file with coordinates for d3js3c_.
(The format of our PDB-style files is described here.)

Timeline for d3js3c_: