SCOPe 2.06: Domain d3js3a_: 3js3 A:

Lineage for d3js3a_ (3js3 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (75 species)
   not a true protein

7. Species Clostridium difficile [TaxId:272563] [189051] (2 PDB entries)

8. Domain d3js3a_: 3js3 A: [178750]
   automated match to d1gqna_
   complexed with dhs

Details for d3js3a_

PDB Entry: 3js3, 2.2 Å

PDB Description: crystal structure of type i 3-dehydroquinate dehydratase (arod) from clostridium difficile with covalent reaction intermediate

PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d3js3a_:

Sequence; same for both SEQRES and ATOM records:

>d3js3a_ c.1.10.0 (A:) automated matches {Clostridium difficile [TaxId: 272563]}
mkrkvqvknitigegrpkicvpiigknkkdiikeakelkdacldiiewrvdffenvenik
evkevlyelrsyihdipllftfrsvveggeklisrdyyttlnkeisntglvdlidvelfm
gdevidevvnfahkkevkviisnhdfnktpkkeeivsrlcrmqelgadlpkiavmpqnek
dvlvlleatnemfkiyadrpiitmsmsgmgvisrlcgeifgsaltfgaaksvsapgqisf
kelnsvlnllhks

Timeline for d3js3a_:

• d3js3a_ first appeared in SCOPe 2.01
  
• d3js3a_ appears in SCOPe 2.05
  
• d3js3a_ appears in SCOPe 2.07
  
• d3js3a_ appears in the current release, SCOPe 2.08