Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (75 species) not a true protein |
Species Clostridium difficile [TaxId:272563] [189051] (2 PDB entries) |
Domain d3js3a_: 3js3 A: [178750] automated match to d1gqna_ complexed with dhs |
PDB Entry: 3js3 (more details), 2.2 Å
SCOPe Domain Sequences for d3js3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3js3a_ c.1.10.0 (A:) automated matches {Clostridium difficile [TaxId: 272563]} mkrkvqvknitigegrpkicvpiigknkkdiikeakelkdacldiiewrvdffenvenik evkevlyelrsyihdipllftfrsvveggeklisrdyyttlnkeisntglvdlidvelfm gdevidevvnfahkkevkviisnhdfnktpkkeeivsrlcrmqelgadlpkiavmpqnek dvlvlleatnemfkiyadrpiitmsmsgmgvisrlcgeifgsaltfgaaksvsapgqisf kelnsvlnllhks
Timeline for d3js3a_: