Lineage for d3jrmk_ (3jrm K:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1935363Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 1936338Species Thermoplasma acidophilum [TaxId:2303] [56253] (5 PDB entries)
  8. 1936342Domain d3jrmk_: 3jrm K: [178734]
    Other proteins in same PDB: d3jrma_, d3jrmb_, d3jrmc_, d3jrmd_, d3jrme_, d3jrmf_, d3jrmg_, d3jrmo_, d3jrmp_, d3jrmq_, d3jrmr_, d3jrms_, d3jrmt_, d3jrmu_
    automated match to d1pma1_

Details for d3jrmk_

PDB Entry: 3jrm (more details), 2.9 Å

PDB Description: crystal structure of archaeal 20s proteasome in complex with mutated p26 activator
PDB Compounds: (K:) Proteasome subunit beta

SCOPe Domain Sequences for d3jrmk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jrmk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Thermoplasma acidophilum [TaxId: 2303]}
tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
kdgyvqlptdqiesrirklglil

SCOPe Domain Coordinates for d3jrmk_:

Click to download the PDB-style file with coordinates for d3jrmk_.
(The format of our PDB-style files is described here.)

Timeline for d3jrmk_: