Lineage for d3jr8b_ (3jr8 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338840Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2338841Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2338846Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 protein domains)
    automatically mapped to Pfam PF00068
  6. 2339218Protein automated matches [190139] (26 species)
    not a true protein
  7. 2339319Species Jararacussu (Bothrops jararacussu) [TaxId:8726] [186913] (7 PDB entries)
  8. 2339327Domain d3jr8b_: 3jr8 B: [178719]
    automated match to d1gmza_
    complexed with ca

Details for d3jr8b_

PDB Entry: 3jr8 (more details), 2.1 Å

PDB Description: Crystal Structure of BthTX-II (Asp49-PLA2 from Bothrops jararacussu snake venom) with calcium ions
PDB Compounds: (B:) Phospholipase A2 bothropstoxin-2

SCOPe Domain Sequences for d3jr8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jr8b_ a.133.1.2 (B:) automated matches {Jararacussu (Bothrops jararacussu) [TaxId: 8726]}
dlwqfgqmilketgklpfpyyttygcycgwggqgqpkdatdrccfvhdccygkltnckpk
tdrysysrengviicgegtpcekqicecdkaaavcfrenlrtykkrymaypdvlckkpae
kc

SCOPe Domain Coordinates for d3jr8b_:

Click to download the PDB-style file with coordinates for d3jr8b_.
(The format of our PDB-style files is described here.)

Timeline for d3jr8b_: