Lineage for d3jqxc1 (3jqx C:862-981)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775052Species Clostridium histolyticum [TaxId:1498] [267692] (2 PDB entries)
  8. 2775058Domain d3jqxc1: 3jqx C:862-981 [178712]
    Other proteins in same PDB: d3jqxc2
    automated match to d1nqda_
    complexed with ca, cd

Details for d3jqxc1

PDB Entry: 3jqx (more details), 2.2 Å

PDB Description: Crystal structure of Clostridium histolyticum colH collagenase collagen binding domain 3 at 2.2 Angstrom resolution in the presence of calcium and cadmium
PDB Compounds: (C:) ColH protein

SCOPe Domain Sequences for d3jqxc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jqxc1 b.18.1.0 (C:862-981) automated matches {Clostridium histolyticum [TaxId: 1498]}
vypigtekepnnsketasgpivpgipvsgtientsdqdyfyfdvitpgevkidinklgyg
gatwvvydennnavsyatddgqnlsgkfkadkpgryyihlymfngsympyriniegsvgr

SCOPe Domain Coordinates for d3jqxc1:

Click to download the PDB-style file with coordinates for d3jqxc1.
(The format of our PDB-style files is described here.)

Timeline for d3jqxc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3jqxc2