![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (51 species) not a true protein |
![]() | Species Clostridium histolyticum [TaxId:1498] [267692] (2 PDB entries) |
![]() | Domain d3jqxb_: 3jqx B: [178711] Other proteins in same PDB: d3jqxc2 automated match to d1nqda_ complexed with ca, cd |
PDB Entry: 3jqx (more details), 2.2 Å
SCOPe Domain Sequences for d3jqxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jqxb_ b.18.1.0 (B:) automated matches {Clostridium histolyticum [TaxId: 1498]} vypigtekepnnsketasgpivpgipvsgtientsdqdyfyfdvitpgevkidinklgyg gatwvvydennnavsyatddgqnlsgkfkadkpgryyihlymfngsympyriniegsvgr
Timeline for d3jqxb_: