| Class b: All beta proteins [48724] (178 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
| Protein automated matches [190770] (49 species) not a true protein |
| Species Clostridium histolyticum [TaxId:1498] [267692] (2 PDB entries) |
| Domain d3jqwb_: 3jqw B: [178708] Other proteins in same PDB: d3jqwc2 automated match to d1nqda_ complexed with ca |
PDB Entry: 3jqw (more details), 2 Å
SCOPe Domain Sequences for d3jqwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jqwb_ b.18.1.0 (B:) automated matches {Clostridium histolyticum [TaxId: 1498]}
vypigtekepnnsketasgpivpgipvsgtientsdqdyfyfdvitpgevkidinklgyg
gatwvvydennnavsyatddgqnlsgkfkadkpgryyihlymfngsympyriniegsvgr
Timeline for d3jqwb_: