Lineage for d3jqla_ (3jql A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 925252Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 925253Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 925258Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
  6. 925358Protein Snake phospholipase A2 [48624] (35 species)
  7. 925374Species Andaman cobra (Naja sagittifera), isoform 4 [TaxId:195058] [89171] (14 PDB entries)
    Uniprot P60045 8-126 # ! yet another isoform, 98% identity
  8. 925375Domain d3jqla_: 3jql A: [178697]
    automated match to d1ln8a_
    complexed with ca

Details for d3jqla_

PDB Entry: 3jql (more details), 1.2 Å

PDB Description: Crystal Structure of the Complex Formed Between Phospholipase A2 and a Hexapeptide Fragment of Amyloid Beta Peptide, Lys-Leu-Val-Phe-Phe-Ala at 1.2 A Resolution
PDB Compounds: (A:) Phospholipase A2 isoform 3

SCOPe Domain Sequences for d3jqla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jqla_ a.133.1.2 (A:) Snake phospholipase A2 {Andaman cobra (Naja sagittifera), isoform 4 [TaxId: 195058]}
nlyqfknmiqctvpsrswadfadygcycgkggsgtpvddldrccqthdncyneaenisgc
rpyfktysyectqgtltckgdnnacaasvcdcdrlaaicfagapyndanynidlkarcn

SCOPe Domain Coordinates for d3jqla_:

Click to download the PDB-style file with coordinates for d3jqla_.
(The format of our PDB-style files is described here.)

Timeline for d3jqla_: