Lineage for d3jqjl_ (3jqj L:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1029548Superfamily d.58.21: Molybdenum cofactor biosynthesis protein C, MoaC [55040] (2 families) (S)
  5. 1029554Family d.58.21.0: automated matches [191458] (1 protein)
    not a true family
  6. 1029555Protein automated matches [190706] (2 species)
    not a true protein
  7. 1029558Species Thermus thermophilus [TaxId:300852] [187852] (5 PDB entries)
  8. 1029572Domain d3jqjl_: 3jqj L: [178695]
    automated match to d1ekra_
    complexed with gol, pgr, po4

Details for d3jqjl_

PDB Entry: 3jqj (more details), 1.9 Å

PDB Description: Crystal structure of the molybdenum cofactor biosynthesis protein C (TTHA1789) from Thermus Theromophilus HB8
PDB Compounds: (L:) Molybdenum cofactor biosynthesis protein C

SCOPe Domain Sequences for d3jqjl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jqjl_ d.58.21.0 (L:) automated matches {Thermus thermophilus [TaxId: 300852]}
rprmvdvtekpetfrtataeafvelteealsalekggvgkgdplvvaqlagilaakktad
liplchplpltgvevrvellkaekrvrieatvktkaetgvemeamtacavaaltvydmlk
aaskglvisqvrllhkaggksgewrre

SCOPe Domain Coordinates for d3jqjl_:

Click to download the PDB-style file with coordinates for d3jqjl_.
(The format of our PDB-style files is described here.)

Timeline for d3jqjl_: