| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.21: Molybdenum cofactor biosynthesis protein C, MoaC [55040] (2 families) ![]() |
| Family d.58.21.0: automated matches [191458] (1 protein) not a true family |
| Protein automated matches [190706] (2 species) not a true protein |
| Species Thermus thermophilus [TaxId:300852] [187852] (5 PDB entries) |
| Domain d3jqjf_: 3jqj F: [178689] automated match to d1ekra_ complexed with gol, pgr, po4 |
PDB Entry: 3jqj (more details), 1.9 Å
SCOPe Domain Sequences for d3jqjf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jqjf_ d.58.21.0 (F:) automated matches {Thermus thermophilus [TaxId: 300852]}
rprmvdvtekpetfrtataeafvelteealsalekggvgkgdplvvaqlagilaakktad
liplchplpltgvevrvellkaekrvrieatvktkaetgvemeamtacavaaltvydmlk
aaskglvisqvrllhkaggksgewrre
Timeline for d3jqjf_: