Lineage for d3jq5a_ (3jq5 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733039Protein Snake phospholipase A2 [48624] (38 species)
  7. 2733055Species Andaman cobra (Naja sagittifera), isoform 4 [TaxId:195058] [89171] (14 PDB entries)
    Uniprot P60045 8-126 # ! yet another isoform, 98% identity
  8. 2733063Domain d3jq5a_: 3jq5 A: [178683]
    automated match to d1ln8a_
    complexed with ca

Details for d3jq5a_

PDB Entry: 3jq5 (more details), 2.03 Å

PDB Description: Phospholipase A2 Prevents the Aggregation of Amyloid Beta Peptides: Crystal Structure of the Complex of Phospholipase A2 with Octapeptide Fragment of Amyloid Beta Peptide, Asp-Ala-Glu-Phe-Arg-His-Asp-Ser at 2 A Resolution
PDB Compounds: (A:) Phospholipase A2 isoform 3

SCOPe Domain Sequences for d3jq5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jq5a_ a.133.1.2 (A:) Snake phospholipase A2 {Andaman cobra (Naja sagittifera), isoform 4 [TaxId: 195058]}
nlyqfknmiqctvpsrswadfadygcycgkggsgtpvddldrccqthdncyneaenisgc
rpyfktysyectqgtltckgdnnacaasvcdcdrlaaicfagapyndanynidlkarcn

SCOPe Domain Coordinates for d3jq5a_:

Click to download the PDB-style file with coordinates for d3jq5a_.
(The format of our PDB-style files is described here.)

Timeline for d3jq5a_: