![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.5: TMV-like viral coat proteins [47195] (1 family) ![]() automatically mapped to Pfam PF00721 |
![]() | Family a.24.5.1: TMV-like viral coat proteins [47196] (4 proteins) |
![]() | Protein automated matches [191299] (2 species) not a true protein |
![]() | Species Tobacco mosaic virus [TaxId:12243] [189975] (1 PDB entry) |
![]() | Domain d3j06a_: 3j06 A: [178682] automated match to d1ei7a_ |
PDB Entry: 3j06 (more details), 3.3 Å
SCOPe Domain Sequences for d3j06a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3j06a_ a.24.5.1 (A:) automated matches {Tobacco mosaic virus [TaxId: 12243]} sittpsqfvflssawadpielinlctnalgnqfqtqqartvvqrqfsevwkpspqvtvrf pdsdfkvyrynavldplvtallgafdtrnriievenqanpttaetldatrrvddatvair sainnlivelirgtgsynrssfesssglvwtsgpa
Timeline for d3j06a_: