Lineage for d3j06a_ (3j06 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2699952Superfamily a.24.5: TMV-like viral coat proteins [47195] (1 family) (S)
    automatically mapped to Pfam PF00721
  5. 2699953Family a.24.5.1: TMV-like viral coat proteins [47196] (4 proteins)
  6. 2699996Protein automated matches [191299] (2 species)
    not a true protein
  7. 2699999Species Tobacco mosaic virus [TaxId:12243] [189975] (1 PDB entry)
  8. 2700000Domain d3j06a_: 3j06 A: [178682]
    automated match to d1ei7a_

Details for d3j06a_

PDB Entry: 3j06 (more details), 3.3 Å

PDB Description: cryoem helical reconstruction of tmv
PDB Compounds: (A:) coat protein

SCOPe Domain Sequences for d3j06a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3j06a_ a.24.5.1 (A:) automated matches {Tobacco mosaic virus [TaxId: 12243]}
sittpsqfvflssawadpielinlctnalgnqfqtqqartvvqrqfsevwkpspqvtvrf
pdsdfkvyrynavldplvtallgafdtrnriievenqanpttaetldatrrvddatvair
sainnlivelirgtgsynrssfesssglvwtsgpa

SCOPe Domain Coordinates for d3j06a_:

Click to download the PDB-style file with coordinates for d3j06a_.
(The format of our PDB-style files is described here.)

Timeline for d3j06a_: