SCOPe 2.08: Domain d3j06a_: 3j06 A:

Lineage for d3j06a_ (3j06 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.5: TMV-like viral coat proteins [47195] (1 family)
   automatically mapped to Pfam PF00721

5. Family a.24.5.1: TMV-like viral coat proteins [47196] (4 proteins)

6. Protein automated matches [191299] (2 species)
   not a true protein

7. Species Tobacco mosaic virus [TaxId:12243] [189975] (1 PDB entry)

8. Domain d3j06a_: 3j06 A: [178682]
   automated match to d1ei7a_

Details for d3j06a_

PDB Entry: 3j06, 3.3 Å

PDB Description: cryoem helical reconstruction of tmv

PDB Compounds: (A:) coat protein

SCOPe Domain Sequences for d3j06a_:

Sequence; same for both SEQRES and ATOM records:

>d3j06a_ a.24.5.1 (A:) automated matches {Tobacco mosaic virus [TaxId: 12243]}
sittpsqfvflssawadpielinlctnalgnqfqtqqartvvqrqfsevwkpspqvtvrf
pdsdfkvyrynavldplvtallgafdtrnriievenqanpttaetldatrrvddatvair
sainnlivelirgtgsynrssfesssglvwtsgpa

Timeline for d3j06a_:

• d3j06a_ first appeared in SCOPe 2.01
  
• d3j06a_ appears in SCOPe 2.07