Lineage for d3ixpd_ (3ixp D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009403Protein automated matches [190059] (14 species)
    not a true protein
  7. 2009421Species Cotton bollworm (Helicoverpa armigera) [TaxId:29058] [189564] (1 PDB entry)
  8. 2009422Domain d3ixpd_: 3ixp D: [178681]
    Other proteins in same PDB: d3ixpa_
    automated match to d1r20d_
    complexed with 834, eph

Details for d3ixpd_

PDB Entry: 3ixp (more details), 2.85 Å

PDB Description: crystal structure of the ecdysone receptor bound to byi08346
PDB Compounds: (D:) Ecdysone receptor

SCOPe Domain Sequences for d3ixpd_:

Sequence, based on SEQRES records: (download)

>d3ixpd_ a.123.1.1 (D:) automated matches {Cotton bollworm (Helicoverpa armigera) [TaxId: 29058]}
vppltanqksliarlvyyqegyeqpseedlkrvtqtwqsdeddedsdmpfrqitemtilt
vqlivefakglpgfskisqsdqitllkacssevmmlrvarrydaatdsvlfannqaytrd
nyrkagmayviedllhfcrcmysmmmdnvhyalltaivifsdrpgleqpslveeiqryyl
ntlrvyilnqnsasprsavifgkilgilteirtlgmqnsnmcislklknrklppfleeiw
dva

Sequence, based on observed residues (ATOM records): (download)

>d3ixpd_ a.123.1.1 (D:) automated matches {Cotton bollworm (Helicoverpa armigera) [TaxId: 29058]}
vppltanqksliarlvyyqegyeqmpfrqitemtiltvqlivefakglpgfskisqsdqi
tllkacssevmmlrvarrydaatdsvlfannqaytrdnyrkagmayviedllhfcrcmys
mmmdnvhyalltaivifsdrpgleqpslveeiqryylntlrvyilnqnsasprsavifgk
ilgilteirtlgmqnsnmcislklknrklppfleeiwdva

SCOPe Domain Coordinates for d3ixpd_:

Click to download the PDB-style file with coordinates for d3ixpd_.
(The format of our PDB-style files is described here.)

Timeline for d3ixpd_: