Lineage for d3ixpa_ (3ixp A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009346Protein Ultraspiracle protein, usp [48534] (2 species)
    the ortholog of RXRs in insects
  7. 2009354Species Tobacco budworm (Heliothis virescens) [TaxId:7102] [63626] (4 PDB entries)
  8. 2009356Domain d3ixpa_: 3ixp A: [178680]
    Other proteins in same PDB: d3ixpd_
    automated match to d1g2na_
    complexed with 834, eph

Details for d3ixpa_

PDB Entry: 3ixp (more details), 2.85 Å

PDB Description: crystal structure of the ecdysone receptor bound to byi08346
PDB Compounds: (A:) Gene regulation protein

SCOPe Domain Sequences for d3ixpa_:

Sequence, based on SEQRES records: (download)

>d3ixpa_ a.123.1.1 (A:) Ultraspiracle protein, usp {Tobacco budworm (Heliothis virescens) [TaxId: 7102]}
qelsierllemeslvadpseefqflrvgpdsnvppkfrapvsslcqignkqiaalvvwar
diphfsqlemedqillikgswnelllfaiawrsmeflteerdgvdgtgnrttsppqlmcl
mpgmtlhrnsalqagvgqifdrvlselslkmrtlrvdqaeyvalkaiillnpdvkglknr
qevevlrekmflcldeycrrsrsseegrfaalllrlpalrsislksfehlfffhlvadts
iagyirdalrnhappi

Sequence, based on observed residues (ATOM records): (download)

>d3ixpa_ a.123.1.1 (A:) Ultraspiracle protein, usp {Tobacco budworm (Heliothis virescens) [TaxId: 7102]}
qelsierllemeslvadpseefqflrvgpdsnvppkfrapvsslcqignkqiaalvvwar
diphfsqlemedqillikgswnelllfaiawrsmefltsppqlmclmpgmtlhrnsalqa
gvgqifdrvlselslkmrtlrvdqaeyvalkaiillnpdvkglknrqevevlrekmflcl
deycrrsrsseegrfaalllrlpalrsislksfehlfffhlvadtsiagyirdalrnhap
pi

SCOPe Domain Coordinates for d3ixpa_:

Click to download the PDB-style file with coordinates for d3ixpa_.
(The format of our PDB-style files is described here.)

Timeline for d3ixpa_: