Lineage for d3ixfb_ (3ixf B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1475069Protein automated matches [190359] (38 species)
    not a true protein
  7. 1475070Species Amphitrite ornata [TaxId:129555] [189339] (3 PDB entries)
  8. 1475072Domain d3ixfb_: 3ixf B: [178668]
    automated match to d1ew6a_
    complexed with hem, oxy, so4

Details for d3ixfb_

PDB Entry: 3ixf (more details), 1.58 Å

PDB Description: Crystal Structure of Dehaloperoxidase B at 1.58 and Structural Characterization of the AB Dimer from Amphitrite ornata
PDB Compounds: (B:) Dehaloperoxidase B

SCOPe Domain Sequences for d3ixfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ixfb_ a.1.1.2 (B:) automated matches {Amphitrite ornata [TaxId: 129555]}
gfkqdiatlrgdlrtyaqdiflaflnkypdekrnfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdastlvqmkqhsglttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

SCOPe Domain Coordinates for d3ixfb_:

Click to download the PDB-style file with coordinates for d3ixfb_.
(The format of our PDB-style files is described here.)

Timeline for d3ixfb_: