SCOPe 2.08: Domain d3iwxa_: 3iwx A:

Lineage for d3iwxa_ (3iwx A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families)

5. Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)

6. Protein ATX1 metallochaperone protein (ATOX1) [55014] (3 species)

7. Species Human (Homo sapiens), HAH1 [TaxId:9606] [55016] (17 PDB entries)
   Uniprot O00244

8. Domain d3iwxa_: 3iwx A: [178660]
   automated match to d1fe0b_
   complexed with cpt, so4

Details for d3iwxa_

PDB Entry: 3iwx, 2.14 Å

PDB Description: Crystal structure of cisplatin bound to a human copper chaperone (dimer)

PDB Compounds: (A:) copper transport protein atox1

SCOPe Domain Sequences for d3iwxa_:

Sequence; same for both SEQRES and ATOM records:

>d3iwxa_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]}
pkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgkt
vsylgle

Timeline for d3iwxa_:

• d3iwxa_ first appeared in SCOPe 2.01
  
• d3iwxa_ appears in SCOPe 2.07