Lineage for d3iwtc_ (3iwt C:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 998094Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 998095Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) (S)
  5. 998224Family c.57.1.0: automated matches [191349] (1 protein)
    not a true family
  6. 998225Protein automated matches [190284] (2 species)
    not a true protein
  7. 998232Species Sulfolobus tokodaii [TaxId:111955] [189061] (1 PDB entry)
  8. 998235Domain d3iwtc_: 3iwt C: [178659]
    automated match to d1y5ea1
    complexed with gol, mg, peg

Details for d3iwtc_

PDB Entry: 3iwt (more details), 1.9 Å

PDB Description: structure of hypothetical molybdenum cofactor biosynthesis protein b from sulfolobus tokodaii
PDB Compounds: (C:) 178aa long hypothetical molybdenum cofactor biosynthesis protein B

SCOPe Domain Sequences for d3iwtc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iwtc_ c.57.1.0 (C:) automated matches {Sulfolobus tokodaii [TaxId: 111955]}
pkslnfyvitistsryekllkkepivdesgdiikqllienghkiigyslvpddkikilka
ftdalsidevdviistggtgysptditvetirklfdreiegfsdvfrlvsfndpevkaaa
yltkasagiigkkivyllpgspdavklalkelilpevghlvylvrs

SCOPe Domain Coordinates for d3iwtc_:

Click to download the PDB-style file with coordinates for d3iwtc_.
(The format of our PDB-style files is described here.)

Timeline for d3iwtc_: