Lineage for d3iwtb_ (3iwt B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2497903Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 2497904Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) (S)
  5. 2498046Family c.57.1.0: automated matches [191349] (1 protein)
    not a true family
  6. 2498047Protein automated matches [190284] (9 species)
    not a true protein
  7. 2498082Species Sulfolobus tokodaii [TaxId:111955] [189061] (2 PDB entries)
  8. 2498087Domain d3iwtb_: 3iwt B: [178658]
    automated match to d1y5ea1
    complexed with gol, mg, peg

Details for d3iwtb_

PDB Entry: 3iwt (more details), 1.9 Å

PDB Description: structure of hypothetical molybdenum cofactor biosynthesis protein b from sulfolobus tokodaii
PDB Compounds: (B:) 178aa long hypothetical molybdenum cofactor biosynthesis protein B

SCOPe Domain Sequences for d3iwtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iwtb_ c.57.1.0 (B:) automated matches {Sulfolobus tokodaii [TaxId: 111955]}
pkslnfyvitistsryekllkkepivdesgdiikqllienghkiigyslvpddkikilka
ftdalsidevdviistggtgysptditvetirklfdreiegfsdvfrlvsfndpevkaaa
yltkasagiigkkivyllpgspdavklalkelilpevghlvylvrs

SCOPe Domain Coordinates for d3iwtb_:

Click to download the PDB-style file with coordinates for d3iwtb_.
(The format of our PDB-style files is described here.)

Timeline for d3iwtb_: