| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold |
Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) ![]() |
| Family c.57.1.0: automated matches [191349] (1 protein) not a true family |
| Protein automated matches [190284] (9 species) not a true protein |
| Species Sulfolobus tokodaii [TaxId:111955] [189061] (2 PDB entries) |
| Domain d3iwtb_: 3iwt B: [178658] automated match to d1y5ea1 complexed with gol, mg, peg |
PDB Entry: 3iwt (more details), 1.9 Å
SCOPe Domain Sequences for d3iwtb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iwtb_ c.57.1.0 (B:) automated matches {Sulfolobus tokodaii [TaxId: 111955]}
pkslnfyvitistsryekllkkepivdesgdiikqllienghkiigyslvpddkikilka
ftdalsidevdviistggtgysptditvetirklfdreiegfsdvfrlvsfndpevkaaa
yltkasagiigkkivyllpgspdavklalkelilpevghlvylvrs
Timeline for d3iwtb_: