Lineage for d3iwta_ (3iwt A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1862514Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 1862515Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) (S)
  5. 1862644Family c.57.1.0: automated matches [191349] (1 protein)
    not a true family
  6. 1862645Protein automated matches [190284] (9 species)
    not a true protein
  7. 1862672Species Sulfolobus tokodaii [TaxId:111955] [189061] (1 PDB entry)
  8. 1862673Domain d3iwta_: 3iwt A: [178657]
    automated match to d1y5ea1
    complexed with gol, mg, peg

Details for d3iwta_

PDB Entry: 3iwt (more details), 1.9 Å

PDB Description: structure of hypothetical molybdenum cofactor biosynthesis protein b from sulfolobus tokodaii
PDB Compounds: (A:) 178aa long hypothetical molybdenum cofactor biosynthesis protein B

SCOPe Domain Sequences for d3iwta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iwta_ c.57.1.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 111955]}
pkslnfyvitistsryekllkkepivdesgdiikqllienghkiigyslvpddkikilka
ftdalsidevdviistggtgysptditvetirklfdreiegfsdvfrlvsfndpevkaaa
yltkasagiigkkivyllpgspdavklalkelilpevghlvylvrs

SCOPe Domain Coordinates for d3iwta_:

Click to download the PDB-style file with coordinates for d3iwta_.
(The format of our PDB-style files is described here.)

Timeline for d3iwta_: