SCOPe 2.01: Domain d3iwta_: 3iwt A:

Lineage for d3iwta_ (3iwt A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold

4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families)

5. Family c.57.1.0: automated matches [191349] (1 protein)
   not a true family

6. Protein automated matches [190284] (2 species)
   not a true protein

7. Species Sulfolobus tokodaii [TaxId:111955] [189061] (1 PDB entry)

8. Domain d3iwta_: 3iwt A: [178657]
   automated match to d1y5ea1
   complexed with gol, mg, peg

Details for d3iwta_

PDB Entry: 3iwt, 1.9 Å

PDB Description: structure of hypothetical molybdenum cofactor biosynthesis protein b from sulfolobus tokodaii

PDB Compounds: (A:) 178aa long hypothetical molybdenum cofactor biosynthesis protein B

SCOPe Domain Sequences for d3iwta_:

Sequence; same for both SEQRES and ATOM records:

>d3iwta_ c.57.1.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 111955]}
pkslnfyvitistsryekllkkepivdesgdiikqllienghkiigyslvpddkikilka
ftdalsidevdviistggtgysptditvetirklfdreiegfsdvfrlvsfndpevkaaa
yltkasagiigkkivyllpgspdavklalkelilpevghlvylvrs

Timeline for d3iwta_:

• d3iwta_ is new in SCOPe 2.01-stable
  
• d3iwta_ appears in SCOPe 2.02
  
• d3iwta_ appears in the current release, SCOPe 2.08