SCOPe 2.05: Domain d3iwqb_: 3iwq B:

Lineage for d3iwqb_ (3iwq B:)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein AMPC beta-Lactamase, class C [56618] (4 species)
   contains small alpha+beta subdomain inserted in the common fold

7. Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (97 PDB entries)

8. Domain d3iwqb_: 3iwq B: [178656]
   automated match to d1c3ba_
   complexed with po4; mutant

Details for d3iwqb_

PDB Entry: 3iwq, 1.84 Å

PDB Description: x-ray crystal structure of the extended-spectrum ampc e219k mutant beta-lactamase at 1.84 angstrom resolution

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d3iwqb_:

Sequence; same for both SEQRES and ATOM records:

>d3iwqb_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldakaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

Timeline for d3iwqb_:

• d3iwqb_ first appeared in SCOPe 2.01
  
• d3iwqb_ appears in SCOPe 2.04
  
• d3iwqb_ appears in SCOPe 2.06
  
• d3iwqb_ appears in the current release, SCOPe 2.08