SCOPe 2.06: Domain d3ivva1: 3ivv A:28-165

Lineage for d3ivva1 (3ivv A:28-165)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.8: TRAF domain-like [49598] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.8.1: TRAF domain-like [49599] (3 families)
   has a circularly permuted immunoglobulin-fold topology with extra strand

5. Family b.8.1.1: MATH domain [49600] (5 proteins)
   automatically mapped to Pfam PF00917

6. Protein Speckle-type poz protein SPOP [141107] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141108] (7 PDB entries)
   Uniprot O43791 28-173

8. Domain d3ivva1: 3ivv A:28-165 [178637]
   Other proteins in same PDB: d3ivva2
   automated match to d2cr2a1

Details for d3ivva1

PDB Entry: 3ivv, 1.25 Å

PDB Description: structures of spop-substrate complexes: insights into molecular architectures of btb-cul3 ubiquitin ligases: spopmath-pucsbc1_pep1

PDB Compounds: (A:) Speckle-type POZ protein

SCOPe Domain Sequences for d3ivva1:

Sequence; same for both SEQRES and ATOM records:

>d3ivva1 b.8.1.1 (A:28-165) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]}
kvvkfsymwtinnfsfcreemgeviksstfssgandklkwclrvnpkgldeeskdylsly
lllvscpksevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrdflldean
gllpddkltlfcevsvvq

Timeline for d3ivva1:

• d3ivva1 first appeared in SCOPe 2.01, called d3ivva_
  
• d3ivva1 was called d3ivva_ in SCOPe 2.05
  
• d3ivva1 appears in SCOPe 2.07
  
• d3ivva1 appears in the current release, SCOPe 2.08