![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.8: TRAF domain-like [49598] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.8.1: TRAF domain-like [49599] (3 families) ![]() has a circularly permuted immunoglobulin-fold topology with extra strand |
![]() | Family b.8.1.1: MATH domain [49600] (5 proteins) automatically mapped to Pfam PF00917 |
![]() | Protein Speckle-type poz protein SPOP [141107] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141108] (12 PDB entries) Uniprot O43791 28-173 |
![]() | Domain d3ivva1: 3ivv A:28-165 [178637] Other proteins in same PDB: d3ivva2 automated match to d2cr2a1 |
PDB Entry: 3ivv (more details), 1.25 Å
SCOPe Domain Sequences for d3ivva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ivva1 b.8.1.1 (A:28-165) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]} kvvkfsymwtinnfsfcreemgeviksstfssgandklkwclrvnpkgldeeskdylsly lllvscpksevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrdflldean gllpddkltlfcevsvvq
Timeline for d3ivva1: