![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.8: TRAF domain-like [49598] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.8.1: TRAF domain-like [49599] (3 families) ![]() has a circularly permuted immunoglobulin-fold topology with extra strand |
![]() | Family b.8.1.1: MATH domain [49600] (5 proteins) automatically mapped to Pfam PF00917 |
![]() | Protein Speckle-type poz protein SPOP [141107] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141108] (16 PDB entries) Uniprot O43791 28-173 |
![]() | Domain d3ivqa1: 3ivq A:28-166 [178633] Other proteins in same PDB: d3ivqa2, d3ivqb2 automated match to d2cr2a1 |
PDB Entry: 3ivq (more details), 2.1 Å
SCOPe Domain Sequences for d3ivqa1:
Sequence, based on SEQRES records: (download)
>d3ivqa1 b.8.1.1 (A:28-166) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]} kvvkfsymwtinnfsfcreemgeviksstfssgandklkwclrvnpkgldeeskdylsly lllvscpksevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrdflldean gllpddkltlfcevsvvqd
>d3ivqa1 b.8.1.1 (A:28-166) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]} kvvkfsymwtinnfsfcreemgeviksstfssgaklkwclrvnpkgldeeskdylslyll lvscpksevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrdflldeangl lpddkltlfcevsvvqd
Timeline for d3ivqa1: