Lineage for d3ivga_ (3ivg A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860642Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (2 proteins)
    contains C-terminal subdomain similar to one structural repeat of the Creatinase/aminopeptidase family
    automatically mapped to Pfam PF02569
  6. 2860643Protein Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63977] (5 species)
  7. 2860647Species Mycobacterium tuberculosis [TaxId:1773] [89615] (48 PDB entries)
  8. 2860687Domain d3ivga_: 3ivg A: [178627]
    automated match to d1n2ga_
    complexed with edo, eoh, fg5, gol

Details for d3ivga_

PDB Entry: 3ivg (more details), 1.95 Å

PDB Description: crystal structure of pantothenate synthetase in complex with 2-(2- ((benzofuran-2-sulfonamido)methyl)-5-methoxy-1h-indol-1-yl)acetic acid
PDB Compounds: (A:) Pantothenate synthetase

SCOPe Domain Sequences for d3ivga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ivga_ c.26.1.4 (A:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Mycobacterium tuberculosis [TaxId: 1773]}
ipafhpgelnvysapgdvadvsralrltgrrvmlvptmgalheghlalvraakrvpgsvv
vvsifvnpmqfgaggdldayprtpdddlaqlraegveiaftpttaamypdglrttvqpgp
laaeleggprpthfagvltvvlkllqivrpdrvffgekdyqqlvlirqlvadfnldvavv
gvptvreadglamssrnryldpaqraaavalsaaltaaahaatagaqaaldaaravldaa
pgvavdylelrdiglgpmplngsgrllvaarlgttrlldniaieigt

SCOPe Domain Coordinates for d3ivga_:

Click to download the PDB-style file with coordinates for d3ivga_.
(The format of our PDB-style files is described here.)

Timeline for d3ivga_: