SCOPe 2.05: Domain d3ivba_: 3ivb A:

Lineage for d3ivba_ (3ivb A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.8: TRAF domain-like [49598] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.8.1: TRAF domain-like [49599] (3 families)
   has a circularly permuted immunoglobulin-fold topology with extra strand

5. Family b.8.1.1: MATH domain [49600] (5 proteins)
   automatically mapped to Pfam PF00917

6. Protein Speckle-type poz protein SPOP [141107] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141108] (7 PDB entries)
   Uniprot O43791 28-173

8. Domain d3ivba_: 3ivb A: [178624]
   automated match to d2cr2a1
   protein/DNA complex; complexed with cl, zn

Details for d3ivba_

PDB Entry: 3ivb, 1.75 Å

PDB Description: structures of spop-substrate complexes: insights into architectures of btb-cul3 ubiquitin ligases: spopmath-macroh2asbcpep1

PDB Compounds: (A:) Speckle-type POZ protein

SCOPe Domain Sequences for d3ivba_:

Sequence, based on SEQRES records:

>d3ivba_ b.8.1.1 (A:) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]}
kvvkfsymwtinnfsfcreemgeviksstfssgandklkwclrvnpkgldeeskdylsly
lllvscpksevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrdflldean
gllpddkltlfcevsvvq

Sequence, based on observed residues (ATOM records):

>d3ivba_ b.8.1.1 (A:) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]}
kvvkfsymwtinnfsfcreemgeviksstfssgandklkwclrvnpkgldeeskdylsly
lllvscpkevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrdflldeang
llpddkltlfcevsvvq

Timeline for d3ivba_:

• d3ivba_ first appeared in SCOPe 2.01
  
• d3ivba_ appears in SCOPe 2.04
  
• d3ivba_ appears in SCOPe 2.06
  
• d3ivba_ appears in the current release, SCOPe 2.08