Lineage for d3ivba_ (3ivb A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776288Fold b.8: TRAF domain-like [49598] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1776289Superfamily b.8.1: TRAF domain-like [49599] (3 families) (S)
    has a circularly permuted immunoglobulin-fold topology with extra strand
  5. 1776290Family b.8.1.1: MATH domain [49600] (5 protein domains)
    automatically mapped to Pfam PF00917
  6. 1776291Protein Speckle-type poz protein SPOP [141107] (2 species)
  7. 1776292Species Human (Homo sapiens) [TaxId:9606] [141108] (7 PDB entries)
    Uniprot O43791 28-173
  8. 1776298Domain d3ivba_: 3ivb A: [178624]
    automated match to d2cr2a1
    protein/DNA complex; complexed with cl, zn

Details for d3ivba_

PDB Entry: 3ivb (more details), 1.75 Å

PDB Description: structures of spop-substrate complexes: insights into architectures of btb-cul3 ubiquitin ligases: spopmath-macroh2asbcpep1
PDB Compounds: (A:) Speckle-type POZ protein

SCOPe Domain Sequences for d3ivba_:

Sequence, based on SEQRES records: (download)

>d3ivba_ b.8.1.1 (A:) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]}
kvvkfsymwtinnfsfcreemgeviksstfssgandklkwclrvnpkgldeeskdylsly
lllvscpksevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrdflldean
gllpddkltlfcevsvvq

Sequence, based on observed residues (ATOM records): (download)

>d3ivba_ b.8.1.1 (A:) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]}
kvvkfsymwtinnfsfcreemgeviksstfssgandklkwclrvnpkgldeeskdylsly
lllvscpkevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrdflldeang
llpddkltlfcevsvvq

SCOPe Domain Coordinates for d3ivba_:

Click to download the PDB-style file with coordinates for d3ivba_.
(The format of our PDB-style files is described here.)

Timeline for d3ivba_: