SCOPe 2.02: Domain d3it8c_: 3it8 C:

Lineage for d3it8c_ (3it8 C:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.1: TNF-like [49843] (15 proteins)

6. Protein automated matches [190204] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186956] (8 PDB entries)

8. Domain d3it8c_: 3it8 C: [178609]
   automated match to d1tnfa_
   complexed with nag

Details for d3it8c_

PDB Entry: 3it8, 2.8 Å

PDB Description: crystal structure of tnf alpha complexed with a poxvirus mhc-related tnf binding protein

PDB Compounds: (C:) Tumor necrosis factor

SCOPe Domain Sequences for d3it8c_:

Sequence; same for both SEQRES and ATOM records:

>d3it8c_ b.22.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtpsdkpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfk
gqgcpsthvllthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvfq
lekgdrlsaeinrpdyllfaesgqvyfgiial

Timeline for d3it8c_:

• d3it8c_ first appeared in SCOPe 2.01
  
• d3it8c_ appears in SCOPe 2.03
  
• d3it8c_ appears in the current release, SCOPe 2.08