SCOPe 2.05: Domain d3irwp_: 3irw P:

Lineage for d3irwp_ (3irw P:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein Splicesomal U1A protein [54932] (2 species)
   duplication: contains two domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [54933] (48 PDB entries)
   Uniprot P09012 1-97 ! Uniprot P09012 4-98 ! Uniprot P09012 1-98

8. Domain d3irwp_: 3irw P: [178587]
   automated match to d1auda_
   protein/RNA complex; complexed with c2e, iri, mg

Details for d3irwp_

PDB Entry: 3irw, 2.7 Å

PDB Description: structure of a c-di-gmp riboswitch from v. cholerae

PDB Compounds: (P:) U1 small nuclear ribonucleoprotein A

SCOPe Domain Sequences for d3irwp_:

Sequence; same for both SEQRES and ATOM records:

>d3irwp_ d.58.7.1 (P:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}
rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
nalrsmqgfpfydkpmriqyaktdsdiiak

Timeline for d3irwp_:

• d3irwp_ first appeared in SCOPe 2.01
  
• d3irwp_ appears in SCOPe 2.04
  
• d3irwp_ appears in SCOPe 2.06
  
• d3irwp_ appears in the current release, SCOPe 2.08