SCOPe 2.08: Domain d3irub_: 3iru B:

Lineage for d3irub_ (3iru B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (55 species)
   not a true protein

7. Species Oleispira antarctica [TaxId:188908] [189026] (1 PDB entry)

8. Domain d3irub_: 3iru B: [178586]
   automated match to d1rqla_
   complexed with na

Details for d3irub_

PDB Entry: 3iru, 2.3 Å

PDB Description: crystal structure of phoshonoacetaldehyde hydrolase like protein from oleispira antarctica

PDB Compounds: (B:) phoshonoacetaldehyde hydrolase like protein

SCOPe Domain Sequences for d3irub_:

Sequence; same for both SEQRES and ATOM records:

>d3irub_ c.108.1.0 (B:) automated matches {Oleispira antarctica [TaxId: 188908]}
hmlkanvfcagpvealildwagttidfgslapvyafmelfkqegievtqaearepmgtek
sehirrmlgnsrianawlsikgqasneedikrlydlfapiqtrivaqrsqlipgwkevfd
kliaqgikvggntgygpgmmapaliaakeqgytpastvfatdvvrgrpfpdmalkvalel
evghvngcikvddtlpgieeglragmwtvgvscsgnevgldredwqalssdeqqsyrqha
eqrlfnagahyvidsvadletvitdvnrrlargekp

Timeline for d3irub_:

• d3irub_ first appeared in SCOPe 2.01
  
• d3irub_ appears in SCOPe 2.07