Lineage for d3irub_ (3iru B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920580Species Oleispira antarctica [TaxId:188908] [189026] (1 PDB entry)
  8. 2920582Domain d3irub_: 3iru B: [178586]
    automated match to d1rqla_
    complexed with na

Details for d3irub_

PDB Entry: 3iru (more details), 2.3 Å

PDB Description: crystal structure of phoshonoacetaldehyde hydrolase like protein from oleispira antarctica
PDB Compounds: (B:) phoshonoacetaldehyde hydrolase like protein

SCOPe Domain Sequences for d3irub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3irub_ c.108.1.0 (B:) automated matches {Oleispira antarctica [TaxId: 188908]}
hmlkanvfcagpvealildwagttidfgslapvyafmelfkqegievtqaearepmgtek
sehirrmlgnsrianawlsikgqasneedikrlydlfapiqtrivaqrsqlipgwkevfd
kliaqgikvggntgygpgmmapaliaakeqgytpastvfatdvvrgrpfpdmalkvalel
evghvngcikvddtlpgieeglragmwtvgvscsgnevgldredwqalssdeqqsyrqha
eqrlfnagahyvidsvadletvitdvnrrlargekp

SCOPe Domain Coordinates for d3irub_:

Click to download the PDB-style file with coordinates for d3irub_.
(The format of our PDB-style files is described here.)

Timeline for d3irub_: