Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
Protein automated matches [190447] (20 species) not a true protein |
Species Oleispira antarctica [TaxId:188908] [189026] (1 PDB entry) |
Domain d3irua_: 3iru A: [178585] automated match to d1rqla_ complexed with na |
PDB Entry: 3iru (more details), 2.3 Å
SCOPe Domain Sequences for d3irua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3irua_ c.108.1.0 (A:) automated matches {Oleispira antarctica [TaxId: 188908]} hmlkanvfcagpvealildwagttidfgslapvyafmelfkqegievtqaearepmgtek sehirrmlgnsrianawlsikgqasneedikrlydlfapiqtrivaqrsqlipgwkevfd kliaqgikvggntgygpgmmapaliaakeqgytpastvfatdvvrgrpfpdmalkvalel evghvngcikvddtlpgieeglragmwtvgvscsgnevgldredwqalssdeqqsyrqha eqrlfnagahyvidsvadletvitdvnrrlargekp
Timeline for d3irua_: