SCOPe 2.08: Domain d3irtb_: 3irt B:

Lineage for d3irtb_ (3irt B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.6: Ubiquitin carboxyl-terminal hydrolase UCH-L [54050] (3 proteins)
   automatically mapped to Pfam PF01088

6. Protein automated matches [191161] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189359] (4 PDB entries)

8. Domain d3irtb_: 3irt B: [178584]
   automated match to d2etla1
   complexed with cl; mutant

Details for d3irtb_

PDB Entry: 3irt, 2.8 Å

PDB Description: crystal structure of the i93m mutant of ubiquitin carboxy-terminal hydrolase l1

PDB Compounds: (B:) Ubiquitin carboxyl-terminal hydrolase isozyme L1

SCOPe Domain Sequences for d3irtb_:

Sequence; same for both SEQRES and ATOM records:

>d3irtb_ d.3.1.6 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqlkpmeinpemlnkvlsrlgvagqwrfvdvlgleeeslgsvpapacallllfpltaqhe
nfrkkqieelkgqevspkvyfmkqtignscgtmglihavannqdklgfedgsvlkqflse
tekmspedrakcfekneaiqaahdavaqegqcrvddkvnfhfilfnnvdghlyeldgrmp
fpvnhgassedtllkdaakvcreftereqgevrfsavalckaa

Timeline for d3irtb_:

• d3irtb_ first appeared in SCOPe 2.01
  
• d3irtb_ appears in SCOPe 2.07