SCOPe 2.01: Domain d3irta_: 3irt A:

Lineage for d3irta_ (3irt A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.6: Ubiquitin carboxyl-terminal hydrolase UCH-L [54050] (3 proteins)

6. Protein automated matches [191161] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189359] (4 PDB entries)

8. Domain d3irta_: 3irt A: [178583]
   automated match to d2etla1
   complexed with cl; mutant

Details for d3irta_

PDB Entry: 3irt, 2.8 Å

PDB Description: crystal structure of the i93m mutant of ubiquitin carboxy-terminal hydrolase l1

PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase isozyme L1

SCOPe Domain Sequences for d3irta_:

Sequence; same for both SEQRES and ATOM records:

>d3irta_ d.3.1.6 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqlkpmeinpemlnkvlsrlgvagqwrfvdvlgleeeslgsvpapacallllfpltaqhe
nfrkkqieelkgqevspkvyfmkqtignscgtmglihavannqdklgfedgsvlkqflse
tekmspedrakcfekneaiqaahdavaqegqcrvddkvnfhfilfnnvdghlyeldgrmp
fpvnhgassedtllkdaakvcreftereqgevrfsavalckaa

Timeline for d3irta_:

• d3irta_ is new in SCOPe 2.01-stable
  
• d3irta_ appears in SCOPe 2.02
  
• d3irta_ appears in the current release, SCOPe 2.08