SCOPe 2.06: Domain d3irba_: 3irb A:

Lineage for d3irba_ (3irb A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.15: SSO2064-like [159109] (1 protein)
   Pfam PF01796; DUF35; contains extra N-terminal zinc finger subdomain of the rubredoxin-like fold

6. Protein Hypothetical protein SSO2064 [159110] (1 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [159111] (2 PDB entries)
   Uniprot Q97WQ4 8-144

8. Domain d3irba_: 3irb A: [178580]
   complexed with acy, so4, zn

Details for d3irba_

PDB Entry: 3irb, 1.8 Å

PDB Description: crystal structure of protein with unknown function from duf35 family (13815350) from sulfolobus solfataricus at 1.80 a resolution

PDB Compounds: (A:) uncharacterized protein from DUF35 family

SCOPe Domain Sequences for d3irba_:

Sequence; same for both SEQRES and ATOM records:

>d3irba_ b.40.4.15 (A:) Hypothetical protein SSO2064 {Sulfolobus solfataricus [TaxId: 2287]}
kegsllrwydvmeaeryeytvgpageqffnglkqnkiigskcskcgrifvparsycehcf
vkienyveinkdeayvdsytiiynddegnklaqpvyialirfpnieggllcyaegnvkvg
akakilsfqwplrvkvd

Timeline for d3irba_:

• d3irba_ first appeared in SCOPe 2.01
  
• d3irba_ appears in SCOPe 2.05
  
• d3irba_ appears in SCOPe 2.07
  
• d3irba_ appears in the current release, SCOPe 2.08