SCOPe 2.06: Domain d3ir6c_: 3ir6 C:

Lineage for d3ir6c_ (3ir6 C:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.3: Respiratory nitrate reductase 1 gamma chain [103501] (1 family)
   possible link between the two other superfamilies: this subunit corresponds to the gamma subunit of a functionally related Formate dehydrogenase N complex but is structurally closer to the Fumarate reductase subunit FrdC
   automatically mapped to Pfam PF02665

5. Family f.21.3.1: Respiratory nitrate reductase 1 gamma chain [103502] (2 proteins)

6. Protein automated matches [191115] (1 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189179] (4 PDB entries)

8. Domain d3ir6c_: 3ir6 C: [178575]
   Other proteins in same PDB: d3ir6a1, d3ir6a2, d3ir6b_
   automated match to d1q16c_
   complexed with aga, f3s, gdp, hem, sf4; mutant

Details for d3ir6c_

PDB Entry: 3ir6, 2.8 Å

PDB Description: crystal structure of narghi mutant narg-h49s

PDB Compounds: (C:) Respiratory nitrate reductase 1 gamma chain

SCOPe Domain Sequences for d3ir6c_:

Sequence; same for both SEQRES and ATOM records:

>d3ir6c_ f.21.3.1 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mqflnmfffdiypyiagavfligswlrydygqytwraassqmldrkgmnlasnlfhigil
gifvghffgmltphwmyeawlpievkqkmamfaggasgvlcliggvlllkrrlfsprvra
tttgadililsllviqcalglltipfsaqhmdgsemmklvgwaqsvvtfhggasqhldgv
afifrlhlvlgmtlfllfpfsrlihiwsvpveyltrkyqlvrarh

Timeline for d3ir6c_:

• d3ir6c_ first appeared in SCOPe 2.01
  
• d3ir6c_ appears in SCOPe 2.05
  
• d3ir6c_ appears in SCOPe 2.07
  
• d3ir6c_ appears in the current release, SCOPe 2.08