Lineage for d3ir6c_ (3ir6 C:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957178Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 1957392Superfamily f.21.3: Respiratory nitrate reductase 1 gamma chain [103501] (1 family) (S)
    possible link between the two other superfamilies: this subunit corresponds to the gamma subunit of a functionally related Formate dehydrogenase N complex but is structurally closer to the Fumarate reductase subunit FrdC
    automatically mapped to Pfam PF02665
  5. 1957393Family f.21.3.1: Respiratory nitrate reductase 1 gamma chain [103502] (2 proteins)
  6. 1957402Protein automated matches [191115] (1 species)
    not a true protein
  7. 1957403Species Escherichia coli K-12 [TaxId:83333] [189179] (4 PDB entries)
  8. 1957407Domain d3ir6c_: 3ir6 C: [178575]
    Other proteins in same PDB: d3ir6a1, d3ir6a2, d3ir6b_
    automated match to d1q16c_
    complexed with aga, f3s, gdp, hem, sf4; mutant

Details for d3ir6c_

PDB Entry: 3ir6 (more details), 2.8 Å

PDB Description: crystal structure of narghi mutant narg-h49s
PDB Compounds: (C:) Respiratory nitrate reductase 1 gamma chain

SCOPe Domain Sequences for d3ir6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ir6c_ f.21.3.1 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mqflnmfffdiypyiagavfligswlrydygqytwraassqmldrkgmnlasnlfhigil
gifvghffgmltphwmyeawlpievkqkmamfaggasgvlcliggvlllkrrlfsprvra
tttgadililsllviqcalglltipfsaqhmdgsemmklvgwaqsvvtfhggasqhldgv
afifrlhlvlgmtlfllfpfsrlihiwsvpveyltrkyqlvrarh

SCOPe Domain Coordinates for d3ir6c_:

Click to download the PDB-style file with coordinates for d3ir6c_.
(The format of our PDB-style files is described here.)

Timeline for d3ir6c_: